PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.148580.1
Common NameCsa_7G043580, LOC101204619
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 501aa    MW: 54650.2 Da    PI: 6.3115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.148580.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-173279148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +l+d+vk++G g+W+++ ++ g+ R++k+c++rw ++l
   Cucsa.148580.1 32 KGPWTAAEDGILIDYVKKHGEGNWNAVQKHTGLARCGKSCRLRWANHL 79
                     79******************************************9986 PP

2Myb_DNA-binding49.97.5e-1685128146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ ++++++++lG++ W++ a+ ++ gRt++++k++w++
   Cucsa.148580.1  85 KGSFSQEEERIIIELHAKLGNK-WARMAAQLP-GRTDNEIKNYWNT 128
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6542779IPR017930Myb domain
SuperFamilySSF466899.73E-3030126IPR009057Homeodomain-like
SMARTSM007172.8E-133181IPR001005SANT/Myb domain
PfamPF002491.8E-153279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-243386IPR009057Homeodomain-like
CDDcd001671.71E-113479No hitNo description
PROSITE profilePS5129425.98380134IPR017930Myb domain
SMARTSM007175.5E-1684132IPR001005SANT/Myb domain
PfamPF002499.6E-1585128IPR001005SANT/Myb domain
CDDcd001671.62E-1187128No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2587133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MVENKGEKGK SEGDHQNHGG GGGEKGGRAL KKGPWTAAED GILIDYVKKH GEGNWNAVQK  60
HTGLARCGKS CRLRWANHLR PNLKKGSFSQ EEERIIIELH AKLGNKWARM AAQLPGRTDN  120
EIKNYWNTRM KRRQRAGLPL YPLEIQQEAT AFHLRNHHHH HHHNSSSPAA VATNFSVIRH  180
KPDFNNQNSL SIFNFSSTMN NYQKNFNDGS SFLATPTSQF KFFPDNNNGG GFALPLSPVS  240
PFPQIGQQMN QSFSSPPQAA LQFSYGNYVC NSNSGLNSMI LGAPYHNLIP GLETELPSIQ  300
TPPHSTTPAS SGTSGGEGIM AAANSGLLDV VLLEAEARSR NEKQSKEESS SAGEMKQRMD  360
QGSTEEEDAN LYVESVLGSS GGDAAAAEHH SDEFSSSHSS SRKRPRMEPL EEMDSMDDDD  420
LMSLLNNFQS GIPVPEWYPG NSDDDLAMNM QNGPSLCESN GNPGGDEQQQ NVASPTVVAS  480
SPVLEWSLGS SCWNNMPNIH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-33301335107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6817920.0LN681792.1 Cucumis melo genomic scaffold, anchoredscaffold00034.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144591.10.0PREDICTED: transcription factor MYB104
TrEMBLA0A0A0K6U60.0A0A0A0K6U6_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99493240
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-68myb domain protein 33
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]